ReadTheSet
General, scale None

G-002, Symbols, Abbreviations and General Notes

Symbol identification, abbreviation lookup, general notes.

The drawing

G-002 Symbols, Abbreviations and General Notes, Millbrook Branch LibraryARCH D sheet, 36 by 24 inches. No drawing scale. Use the layer tray and the measure tool below the drawing.SYMBOLS LEGENDAGrid bubble, letters one way, numbers the other1A-301Section marker, section over sheet3A-401Detail bubble, detail over sheet5678A-501Interior elevation marker, one per wallCORRIDOR114Room tag, name over number105ADoor tag, room number plus a letterW3Window tag, the window type01Keynote, spelled out in the note list1Revision triangle, the revision numberRevision cloud, the area that changedNNorth arrow, on every planSteel column at a grid intersectionPanelboard, tagged beside the symbolTThermostatSDSmoke detectorCeiling supply diffuserCeiling return air grilleLighting fixture type A, recessed trofferLighting fixture type B, downlightXLighting fixture type C, exit signDuplex receptacleGFCIGround fault receptacle, wet locationsQuadruplex receptacle, four outletsSSingle pole switchS3Three way switch, one of a pairCleanout on a waste lineWater closetLavatoryWater heaterFloor drain18x12Duct, with its size in inches4 in SANPipe, with size and service2'-0"Dimension string, slash ticks and computed textMATCH LINEMatch line, the plan continues on another viewBreak line, the drawing stops, the object does notLeader, arrow on the thing the note names08'-0"16'-0"24'-0"32'-0"1/8" = 1'-0"Bar scale, check it on a resized printMATERIAL HATCHESEarth, undisturbedCast in place concreteBrick veneerBatt or board insulationWood blocking, cutSteel, cutGypsum wall boardScreened, an area drawn for referenceLINE TYPESObject line, something seen on this planAbove or below the plane of the planHidden edge, concealed by what is in frontCentre line, grid line and property lineThree line weights are used on this set. The heaviest is the cutline of a wall or an object the plan slices through. The mediumweight is an object seen but not cut. The lightest carriesdimensions, extension lines, grid lines and hatching.ABBREVIATIONSABBRAFFAHUARCHBLDGBMBRGCBCFMCLCLGCLRCMUCOCOLCONCCONTCWDETDFDIMDRDWGEFELELECELEVEQEXTFDFDNMEANINGAbove finish floorAir handling unitArchitect or architecturalBuildingBeamBearingCatch basinCubic feet per minute, a rate of airflowCentre lineCeilingClearConcrete masonry unitCleanoutColumnConcreteContinuousCold waterDetailDrinking fountainDimensionDoorDrawingExhaust fanElevation, meaning a height above a datumElectricalElevatorEqualExteriorFloor drainFoundationABBRFFFFEFOSFTFTGGFCIGWBHMHRHVACHWIEININVJSTKWLAVLPMBHMCAMECHMTLNTSOAOCOWSJPLPNLRARCPMEANINGFinish floorFinish floor elevationFace of studFoot or feetFootingGround fault circuit interrupterGypsum wall boardHollow metalHour, used with a fire resistance ratingHeating, ventilating and air conditioningHot waterInvert elevation, pipe bottomInch or inchesInvertJoistKilowattLavatory, a washbasinLighting panelThousand Btu per hourMinimum circuit ampacityMechanicalMetalNot to scaleOutside airOn centreOpen web steel joistProperty linePanelReturn airReflected ceiling planABBRRDREINFREVRMROWRTUSASANSCHEDSDSECTSSSTLSTRUCTTTHKTOTOCTOSTYPUGUNOURVIFVTRWWCWHWPXFMRMEANINGRoof drainReinforcing or reinforcementRevisionRoomRight of wayRooftop unitSupply airSanitary, the foul drainage systemScheduleSmoke detectorSectionStainless steelSteelStructuralThermostatThick or thicknessTop ofTop of concreteTop of steelTypicalUndergroundUnless noted otherwiseUrinalVerify in fieldVent through roofWater, or a wide flange shapeWater closetWater heaterWeatherproofTransformerThe full list of abbreviations used on this set is on the reference pages.GENERAL NOTES01. Verify every dimension and every existing condition in the field beforefabricating or ordering any part of the work. Report a disagreementbetween the drawings and the field to the architect before proceeding.02. Do not scale these drawings. Where a dimension is needed and none isshown, ask for it rather than measuring the print.03. Dimensions are to the face of stud, the face of concrete or the face ofmasonry unless the string is marked otherwise.04. A dimension marked CLR is a clear distance to be held. Build to it, andlet the tolerance fall on the neighbouring dimension.05. Spaces marked EQ are equal to one another. Divide the overall dimensionand hold the result.06. The drawings and the specifications are complementary. Work called forby one is called for by both.07. Read every plan with the general notes on this sheet, the keynotes on thesheet itself, and the schedules on A-601.08. Interior partitions are 6 in steel stud at 16 in on centre with one layerof gypsum wall board each side unless a partition type says otherwise.09. Provide fire stopping at every penetration of a rated assembly, and keepthe rating of the assembly the penetration passes through.10. Coordinate the mechanical, plumbing and electrical drawings with thearchitectural and structural drawings before any rough in. Where aconflict cannot be resolved in the field, ask before cutting.11. The mechanical, plumbing and electrical plans show the architectural planas a screened background for reference only. Build the background fromthe architectural sheets, not from a consultant sheet.12. Do not cut, notch or core a structural member without written approval.Sleeve every pipe that passes through a footing or a grade beam.13. Keep the accessible route free of obstruction. Mounting heights shown onthe enlarged plans and interior elevations govern over a general note.14. Patch and finish every surface disturbed by the work to match theadjacent surface.15. Where a detail is drawn as typical, it applies at every similar conditionwhether or not the condition carries a callout.16. Remove rubbish from the site as the work goes. Leave the building broomclean at substantial completion.SHEET IDENTIFICATIONA sheet number is a discipline letter, a hyphen, asheet type digit, then a two digit sequence. SoA-301 is an architectural section, third type,first in its sequence.DISCIPLINE DESIGNATORSGGeneral: cover, symbols, notesCCivil: site, grading, utilitiesAArchitecturalSStructuralMMechanicalPPlumbingEElectricalSHEET TYPE DIGITS0General notes and legends1Plans2Elevations3Sections4Large scale views and details5Enlarged plans and interior elevations6Schedules and diagramsA callout written 3/A-401 means detail 3 on sheetA-401. The number over the line is the drawingnumber, the number under it is the sheet.Northgate Design StudioArchitecture and interiorsStructural and civil: Kestrel EngineeringPROJECTMillbrook Branch Library412 Kestrel Avenue, MillbrookMillbrook Public Library DistrictProject number 2026-114ISSUE2026-08-14 Issued for constructionSCALENoneDRAWNNDSCHECKEDQAREVISIONSNODATEDESCRIPTIONSHEET TITLESymbols, Abbreviations and General NotesSHEET NUMBERG-002
100%

Turn on Measure, then click two points on the drawing.

Layers on G-002

Drag to pan, scroll or pinch to zoom, or use the buttons. With the drawing focused, the arrow keys pan, plus and minus zoom, and 0 fits the sheet. Every tag, marker and dimension is a focusable target: press Tab to walk them and Enter to select one.

9 questions in the bank draw on this sheet.

Drill this sheetToday's drill instead

How to read this sheet

G-002 is the sheet nobody reads first and everybody comes back to. It carries no building. It carries the vocabulary the rest of the set is written in, and it is split into four blocks: the symbols legend, the material hatches and line types, the abbreviations, and the general notes.

Start with the symbols legend on the left. Every symbol here is drawn by the same code that draws it on a plan, at the same proportions, so what you learn here you will recognise on A-101 without translating. Work down it once and name each one out loud. A circle split by a horizontal line with a number over a sheet number is a marker: a section marker if it has a tail and an arrow, a detail bubble if it does not. A four armed circle is an interior elevation marker and each arm carries the drawing number for the wall it points at. A box with a name over a number is a room tag. A hexagon holding a room number and a letter is a door tag; a hexagon holding a bare number is a keynote, and the two look alike until you notice what is inside them. A diamond is a window type. A triangle with a number in it is a revision triangle, and it always sits beside a cloud.

Below the symbols are the material hatches and the line types. A hatch tells you what a cut piece is made of, and you only meet hatches where the drawing cuts something: sections, details, and the poche of a wall in plan. The line types matter just as much. A solid line is something seen. A dashed line is something above or below the plane you are looking at, which is how a plan shows a beam overhead or a footing below. A long dash and short dash line is a centre line, a grid line or a property line.

The abbreviation tables in the middle are the ones worth learning by heart, because a drawing note is written in them. CLR is a clear distance to hold. TYP means the note applies wherever the same condition happens. UNO means the general rule stands unless a local note overrides it. AFF is above finish floor, which is where mounting heights are measured from. VIF is verify in field, and it is an instruction, not a disclaimer.

The general notes on the right are contract language. They are short, they are numbered, and they govern everywhere unless a sheet says otherwise. Note one and note two are the two that catch new readers: verify in the field, and do not scale the drawing. A print can be resized, a plotter can stretch, and a scale rule laid on paper is a guess. If the number you need is not written down, ask for it.

The last block explains how a sheet number is built, so you can find a sheet you have never seen from the callout that sends you there.